PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011074506.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family BES1
Protein Properties Length: 329aa    MW: 35163.3 Da    PI: 9.1664
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011074506.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822210.34.9e-65281551128
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrk.gskpleeaeaagssasaspessl 94 
                     g+++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGwvve+DGttyrk g+kp   +e++g+s++++p+ss 
  XP_011074506.1  28 GAGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEPDGTTYRKvGCKPI-PMEIGGTSTNITPSSSR 121
                     6899******************************************************************7589998.***************** PP

          DUF822  95 qsslkssalaspvesysaspksssfpspssldsi 128
                     + s+ ss++asp++sy++sp+sssfpsps+ d +
  XP_011074506.1 122 NPSPPSSYFASPIPSYQPSPSSSSFPSPSRHDGN 155
                     ******************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.0E-6030153IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MMWEAGGSTA SSSAAGGAGG SGSGDGGGAG RRKPSWRERE NNRRRERRRR AIAAKIYAGL  60
RAQGNYNLPK HCDNNEVLKA LCAEAGWVVE PDGTTYRKVG CKPIPMEIGG TSTNITPSSS  120
RNPSPPSSYF ASPIPSYQPS PSSSSFPSPS RHDGNGPPHP FGFLLNSIPS SLPPLRISNS  180
APVTPPLSSP TRLPKQTFNL ETLAKESMFA LNIPFFAASA PASPTRVQRF TPATIPECDE  240
SDTSTVDSGR WMNFQAYANA ANMVPTSPTF NLVKPVAQLV PSKDAPVDKG KGTEFDFENM  300
AVKPWEGERI HEVGMDDLEL TLGSGNTRV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13049RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074506.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1 isoform X1
SwissprotQ8S3071e-116BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLM1B8X31e-151M1B8X3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-150(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.24e-81BES1 family protein